IGF-1 LR3 1mg

$89.99

Research Studies:

  • Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
  • Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
  • Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
  • Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.
SKU: A-81369 Category:

Description

IGF-1 LR3 1mg is a research-use-only laboratory material supplied for controlled research workflows, compound characterization, and analytical documentation review. It is manufactured under rigorous quality standards to support consistency, traceability, and batch-specific verification for qualified laboratory settings.

Key Product Details

  • Manufactured in accordance with rigorous quality standards to support ≥99% purity, as reflected in batch-specific documentation where available.
  • Every batch is third-party analyzed for identity, assay/potency, and sterility documentation where applicable.
  • Supplied in lyophilized powder form to help preserve stability throughout transport and storage.
  • Produced with lot-level traceability to support research documentation and laboratory recordkeeping.

Research Documentation Context

  • Supports compound characterization in controlled laboratory settings.
  • Provides batch-specific identity and purity documentation for research review.
  • Allows lot-level traceability across laboratory documentation workflows.
  • Supports comparison of product labeling, analytical documentation, and storage information during research planning.
  • Supports analytical review of peptide research materials within a strictly laboratory-focused context.

Specifications and Documentation

  • Certificate of Analysis: Available with batch-specific documentation where applicable.
  • Material Safety Data Sheet: Coming Soon.
  • Handling and Storage Instructions: Coming Soon.
  • Product Form: Lyophilized powder.
  • Purity Specification: ≥99% purity.
  • Intended Use: Laboratory research use only.

IGF-1 LR3 1mg is intended strictly for laboratory research use only. This product is not intended for human or animal consumption, therapeutic use, diagnostic use, clinical use, veterinary use, or as a food, drug, cosmetic, dietary supplement, or household product.

Additional information

CAS No.

946870-92-4

Purity

≥99%

Sequence

MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C331H519N109O101

Molecular Weight

9117.60 g/mol

Synthesis

Solid-phase synthesis

Format

Lyophilized powder

Solubility

Soluble in water or 1% acetic acid

Stability & Storage

Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.

Applications

Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders

Appearance

White lyophilized powder

Shipping Conditions

Shipped at ambient temperature; once received, store at -20°C

Regulatory/Compliance

Manufactured in a facility that adheres to cGMP guidelines

Safety Information

Refer to provided MSDS