IGF-1 LR3 1mg

$89.99

Research Studies:

  • Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
  • Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
  • Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
  • Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.
SKU: A-81369 Category:

Description

Buy Authentic IGF-1 LR3 1mg Online

IGF-1 LR3 1mg is a research-use-only laboratory material supplied for controlled research workflows, compound characterization, and analytical documentation review. It is manufactured under rigorous quality standards to support consistency, traceability, and batch-specific verification for qualified laboratory settings.

What IGF-1 LR3 1mg is:

IGF-1 LR3 = Insulin-like Growth Factor-1 Long Arg3. It’s a synthetic analog of human IGF-1 with 2 modifications: an arginine substituted at position 3, and a 13-amino-acid N-terminal extension. Those changes reduce binding to IGF-binding proteins and increase half-life vs native IGF-1. The “1mg” is the amount of lyophilized powder per vial. It’s sold strictly as a research peptide for laboratory studies, not for human or veterinary use.

Key Product Details of IGF-1 LR3

  • Manufactured in accordance with rigorous quality standards to support ≥99% purity, as reflected in batch-specific documentation where available.
  • Every batch is third-party analyzed for identity, assay/potency, and sterility documentation where applicable.
  • Supplied in lyophilized powder form to help preserve stability throughout transport and storage.
  • Produced with lot-level traceability to support research documentation and laboratory recordkeeping.

Research Documentation Context

  • Supports compound characterization in controlled laboratory settings.
  • Provides batch-specific identity and purity documentation for research review.
  • Allows lot-level traceability across laboratory documentation workflows.
  • Supports comparison of product labeling, analytical documentation, and storage information during research planning.
  • Supports analytical review of peptide research materials within a strictly laboratory-focused context.

Specifications and Documentation

  • Certificate of Analysis: Available with batch-specific documentation where applicable.
  • Product Form: Lyophilized powder.
  • Purity Specification: ≥99% purity.
  • Intended Use: Laboratory research use only.

IGF-1 LR3 1mg is intended strictly for laboratory research use only. This product is not intended for human or animal consumption, therapeutic use, diagnostic use, clinical use, veterinary use, or as a food, drug, cosmetic, dietary supplement, or household product.

How researchers study it*

: In cell culture and animal models, IGF-1 LR3 is used to investigate the IGF-1 receptor signaling pathway. Because it binds poorly to IGFBP-3 and other binding proteins, researchers use it to study prolonged IGF-1 receptor activation without the buffering effect of IGFBPs. Labs use it in models of cell growth, protein synthesis, glucose uptake, and tissue repair pathways.

Why it gets research attention

Native IGF-1 has a half-life of minutes due to rapid binding and clearance. LR3’s modifications give it a half-life of ∼20-30 hours in preclinical models. That lets researchers study sustained IGF-1 signaling with fewer doses. It’s used in vitro to model anabolic signaling cascades, satellite cell activation, and downstream mTOR/Akt pathways in controlled experiments.

Form, purity & handling

IGF-1 LR3 1mg is typically supplied as a white, freeze-dried powder in a sealed sterile vial. Reputable suppliers include a Certificate of Analysis with HPLC and mass spec to confirm sequence and purity, usually >95% for research grade. It’s extremely sensitive to heat, light, and moisture, and can adsorb to glass/plastic, so it’s shipped cold and stored at -20°C or -80°C after reconstitution. Acidic buffers are often used in labs

 Legal + safety status

IGF-1 LR3 is not FDA-approved or approved by other major regulatory agencies for medical use. It’s classified “for research use only, not for human consumption.” Recombinant IGF-1 drugs like mecasermin exist for specific rare pediatric growth disorders, but LR3 is not an approved drug. It’s banned by WADA for athletes. It has no established human dose, safety profile, or pharmaceutical manufacturing standards.

Bottom line

*IGF-1 LR3 1mg* is a research tool used to study prolonged IGF-1 receptor activation in the lab. While IGF-1 biology is well-established, the LR3 analog itself has no approved medical use, clinical efficacy data, or human safety profile. For growth, metabolic, or recovery concerns, talk to a licensed healthcare provider about FDA-approved diagnostics and treatments with clinical data.

Additional information

CAS No.

946870-92-4

Purity

≥99%

Sequence

MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C331H519N109O101

Molecular Weight

9117.60 g/mol

Synthesis

Solid-phase synthesis

Format

Lyophilized powder

Solubility

Soluble in water or 1% acetic acid

Stability & Storage

Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.

Applications

Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders

Appearance

White lyophilized powder

Shipping Conditions

Shipped at ambient temperature; once received, store at -20°C

Regulatory/Compliance

Manufactured in a facility that adheres to cGMP guidelines

Safety Information

Refer to provided MSDS